Amy1a antibody

• Catalog Number: orb582441
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Amy1a
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Human, Porcine, Rabbit
• Reactivity: Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amy1a
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58 kDa
• Target: Amy1a
• UniProt ID: Q99N59
• Protein Sequence: Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV
• NCBI: NP_001010970
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Amy1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Mouse, Target Name: AMY1, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: AMY1, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: Amy1a, Sample Type: Rat Heart lysates, Antibody dilution: 1.0 ug/ml.