AMIGO2 antibody

• Catalog Number: orb582900
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AMIGO2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMIGO2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: AMIGO2
• UniProt ID: Q86SJ2
• Protein Sequence: Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL
• NCBI: NP_862830
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ALI1, DEGA, AMIGO-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: AMIGO2, Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: AMIGO2, Sample Type: RPMI-8226 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: AMIGO2, Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 0.5 ug/ml.