You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb371718 |
---|---|
Category | Antibodies |
Description | AMHR2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 62750 MW |
UniProt ID | Q16671 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Anti-Muellerian hormone type-2 receptor;2.7.11.30; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of K562 cells using anti-AMHR2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of AMHR2 using anti-AMHR2 antibody.Lane 1:human 293T cell; 2:human MCF-7 cell; 3:human HL-60 cell; 4:human Caco-2 cell; 5:human K562 cell; 6:human HepG2 cell; 7:human PC-3 cell; 8:human A549 cell.
IF analysis of AMHR2 using anti-AMHR2 antibody. AMHR2 was detected in an immunocytochemical section of CACO-2 cells.
IHC analysis of AMHR2 using anti-AMHR2 antibody. AMHR2 was detected in paraffin-embedded section of mouse testis tissue.
IHC analysis of AMHR2 using anti-AMHR2 antibody. AMHR2 was detected in paraffin-embedded section of rat testis tissue.
IHC analysis of AMHR2 using anti-AMHR2 antibody. AMHR2 was detected in paraffin-embedded section of human ovarian cancer tissue.
IHC analysis of AMHR2 using anti-AMHR2 antibody. AMHR2 was detected in paraffin-embedded section of human testis cancer tissue.
Filter by Rating