Cart summary

You have no items in your shopping cart.

    Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody

    Catalog Number: orb18543

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb18543
    CategoryAntibodies
    DescriptionAlpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW57768 MW
    UniProt IDP04745
    RRIDAB_10755535
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesAlpha-amylase 1;3.2.1.1;1,4-alpha-D-glucan glucano
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody

    WB analysis of Amylase using anti-Amylase antibody.Lane 1:rat pancreas tissue;2:mouse pancreas tissue.

    Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody

    IHC analysis of Amylase using anti-Amylase antibody. Amylase was detected in paraffin-embedded section of human pancreatic cancer tissues.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars