alpha 1d Adrenergic Receptor/ADRA1A Antibody

• Catalog Number: orb334484
• Category: Antibodies
• Description: alpha 1d Adrenergic Receptor/ADRA1A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 51487 MW
• UniProt ID: P35348
• Sensitivity: > 5000 cells
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Alpha-1A adrenergic receptor;Alpha-1A adrenorecept
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-ADRA1A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of ADRA1A using anti-ADRA1A antibody.Lane 1:Rat Cardiac Muscle Tissue;2:Rat Brain Tissue;3:Rat Liver Tissue;4:Mouse Liver Tissue;5:Mouse Lung Tissue;6:22RV1 Cell;7:SMMC Cell.

IHC analysis of ADRA1A using anti-ADRA1A antibody.ADRA1A was detected in paraffin-embedded section of human liver cancer tissues.

IHC analysis of ADRA1A using anti-ADRA1A antibody.ADRA1A was detected in paraffin-embedded section of rat brain tissue tissues.

IHC analysis of ADRA1A using anti-ADRA1A antibody.ADRA1A was detected in paraffin-embedded section of rat brain tissue tissues.