Cart summary

You have no items in your shopping cart.

    ALDH2 Antibody(monoclonal, 6H2)

    Catalog Number: orb614090

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb614090
    CategoryAntibodies
    DescriptionALDH2 Antibody(monoclonal, 6H2)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number6H2
    Tested applicationsFC, ICC, IF, WB
    ReactivityHuman, Mouse, Rat
    IsotypeMouse IgG1
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW56381
    UniProt IDP05091
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
    Expiration Date12 months from date of receipt.
    ALDH2 Antibody(monoclonal, 6H2)

    Flow Cytometry analysis of SiHa cells using anti-ALDH2 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

    ALDH2 Antibody(monoclonal, 6H2)

    IF analysis of ALDH2 using anti-ALDH2 antibody.

    ALDH2 Antibody(monoclonal, 6H2)

    IF analysis of ALDH2 using anti-ALDH2 antibody.

    ALDH2 Antibody(monoclonal, 6H2)

    WB analysis using anti-ALDH2 antibody.Lane 1:rat liver tissue, Lane 2:rat kidney tissue, Lane 3:rat heart tissue, Lane 4:rat PC-12 cell, Lane 5:mouse liver tissue, Lane 6:mouse Ana-1 cell.

    ALDH2 Antibody(monoclonal, 6H2)

    WB analysis using anti-ALDH2 antibody.Lane 1:HepG2 cell, Lane 2:placenta tissue, Lane 3:HEK293 cell, Lane 4:HL-60 cell, Lane 5:SHG-44 cell, Lane 6:THP-1 cell, Lane 7:K562 cell.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars