You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb614090 |
---|---|
Category | Antibodies |
Description | ALDH2 Antibody(monoclonal, 6H2) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6H2 |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 56381 |
UniProt ID | P05091 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Add 0.2ml of distilled water will yield a concentration of 500μg/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of SiHa cells using anti-ALDH2 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.
IF analysis of ALDH2 using anti-ALDH2 antibody.
IF analysis of ALDH2 using anti-ALDH2 antibody.
WB analysis using anti-ALDH2 antibody.Lane 1:rat liver tissue, Lane 2:rat kidney tissue, Lane 3:rat heart tissue, Lane 4:rat PC-12 cell, Lane 5:mouse liver tissue, Lane 6:mouse Ana-1 cell.
WB analysis using anti-ALDH2 antibody.Lane 1:HepG2 cell, Lane 2:placenta tissue, Lane 3:HEK293 cell, Lane 4:HL-60 cell, Lane 5:SHG-44 cell, Lane 6:THP-1 cell, Lane 7:K562 cell.
Filter by Rating