You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381039 |
---|---|
Category | Antibodies |
Description | ALDH1B1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Monkey, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 57206 MW |
UniProt ID | P30837 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Aldehyde dehydrogenase X, mitochondrial;1.2.1.3;Al Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HEL cells using anti-ALDH1B1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of ALDH1B1 using anti-ALDH1B1 antibody.Lane 1:human HepG2 cell; 2:human K562 cell; 3:human A431 cell; 4:human A549 cell; 5:human U20S cell; 6:human HeLa cell; 7:monkey COS-7 cell.
WB analysis of ALDH1B1 using anti-ALDH1B1 antibody.Lane 1:rat liver tissue; 2:rat testis tissue; 3:rat RH35 cell; 4:mouse brain tissue; 5:mouse liver tissue.
IF analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in an immunocytochemical section of A431 cells.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human colon cancer tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human endometrial adenocarcinoma tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of mouse colon tissue.
IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of rat colon tissue.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating