You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330973 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ALDH1B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57kDa |
Target | ALDH1B1 |
UniProt ID | P30837 |
Protein Sequence | Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
NCBI | NP_000683 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ALDH5 antibody, anti ALDHX antibody, anti MGC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human hepatocytes tissue using ALDH1B1 antibody
Western blot analysis of Hela cell lysate tissue using ALDH1B1 antibody
WB Suggested Anti-ALDH1B1 Antibody, Positive Control: Lane 1: 30 ug human hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.
WB Suggested Anti-ALDH1B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, ALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa.
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating