ALDH1B1 antibody

• Catalog Number: orb330973
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALDH1B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: ALDH1B1
• UniProt ID: P30837
• Protein Sequence: Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
• NCBI: NP_000683
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ALDH5 antibody, anti ALDHX antibody, anti MGC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human hepatocytes tissue using ALDH1B1 antibody

Western blot analysis of Hela cell lysate tissue using ALDH1B1 antibody

WB Suggested Anti-ALDH1B1 Antibody, Positive Control: Lane 1: 30 ug human hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-ALDH1B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, ALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa.