AKR1C1 antibody

• Catalog Number: orb584599
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AKR1C1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AKR1C1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: AKR1C1
• UniProt ID: Q04828
• Protein Sequence: Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
• NCBI: NP_001344
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: C9, DD1, DDH, DDH1, H-37, HBAB, MBAB, HAKRC, DD1/D
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Monkey adrenal gland

Monkey vagina gland

Rabbit Anti-AKR1C1 Antibody, Catalog Number: orb584599, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-AKR1C1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.