AKR1B10 monoclonal antibody (M01), clone 1A6

• Catalog Number: orb2290956
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AKR1B10.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A6
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
• NCBI: NP_064695
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AKR1B10 monoclonal antibody (M01), clone 1A6 Western Blot analysis of AKR1B10 expression in HepG2.

Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to AKR1B10 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6. Lane 1: AKR1B10 transfected lysate(36 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.22 KDa).