You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb18528 |
---|---|
Category | Antibodies |
Description | AKR1B10 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 36020 MW |
UniProt ID | O60218 |
RRID | AB_10750095 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Aldo-keto reductase family 1 member B10;1.1.1.-;AR Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of AKR1B10 using anti-AKR1B10 antibody.Lane 1:human A549 cell; 2:human HepG2 cell.
IF analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in an immunocytochemical section of A549 cells.
IHC analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in paraffin-embedded section of human intestinal cancer tissues.
IHC analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in paraffin-embedded section of human liver cancer tissues.
ICC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating