You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329866 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AKAP10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP10 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71kDa |
Target | AKAP10 |
UniProt ID | O43572 |
Protein Sequence | Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ |
NCBI | NP_009133 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti D-AKAP2 antibody, anti MGC9414 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: AKAP10, Sample Type: 293T, Antibody Dilution: 1.0 ug/mL, AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: RPMI 8226 cell lysate.
IF, IH, WB | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating