AK1 monoclonal antibody (M08), clone M1

• Catalog Number: orb2296249
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant AK1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M1
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• NCBI: AAH01116
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AK1 monoclonal antibody (M08), clone M1 Western Blot analysis of AK1 expression in HeLa.

Detection limit for recombinant GST tagged AK1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 20 ug/ml]

Western Blot detection against Immunogen (47.08 KDa).