You have no items in your shopping cart.
Cart summary
Item 1 of 6
Item 1 of 6
AK1 monoclonal antibody (M06), clone 3A6-1F5
Catalog Number: orb2296251
| Catalog Number | orb2296251 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full length recombinant AK1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 3A6-1F5 |
| Tested applications | ELISA, IF, IP, WB |
| Reactivity | Human |
| Isotype | IgG1 Kappa |
| Immunogen | AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
| NCBI | AAH01116 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (47.08 KDa).
AK1 monoclonal antibody (M06), clone 3A6-1F5 Western Blot analysis of AK1 expression in HeLa.
Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 monoclonal antibody (M06), clone 3A6-1F5. Lane 1: AK1 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate.
Immunoprecipitation of AK1 transfected lysate using anti-AK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AK1 MaxPab rabbit polyclonal antibody.
Western blot analysis of AK1 over-expressed 293 cell line, cotransfected with AK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AK1 monoclonal antibody (M06), clone 3A6-1F5. GAPDH (36.1 kDa) used as specificity and loading control.
