You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329678 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AIRE |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AIRE |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | AIRE |
UniProt ID | O43918 |
Protein Sequence | Synthetic peptide located within the following region: HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL |
NCBI | NP_000374 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AIRE1 antibody, anti APECED antibody, anti AP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
AIRE antibody - N-terminal region (orb329678) validated by WB using human LCL at 1:1000.
Host: Mouse, Target Name: AIRE, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: AIRE, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Rabbit Anti-AIRE Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-AIRE Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Liver.
Filter by Rating