Cart summary

You have no items in your shopping cart.

    AIF/AIFM1 Antibody

    Catalog Number: orb251549

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb251549
    CategoryAntibodies
    DescriptionAIF/AIFM1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW66901 MW
    UniProt IDO95831
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesApoptosis-inducing factor 1, mitochondrial;1.1.1.-
    Read more...
    NoteFor research use only
    Application notesWB: The detection limit for AIF is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    AIF/AIFM1 Antibody

    Flow Cytometry analysis of HeLa cells using anti-AIF antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    AIF/AIFM1 Antibody

    WB analysis of AIF using anti-AIF antibody.Lane 1:human placenta tissue;2:human A549 cell;3:human PC-3 cell;4:human K562 cell;5:human Caco-2 cell;6:human HeLa cell;7:human HL-60 cell;8:human U-87MG cell.

    AIF/AIFM1 Antibody

    WB analysis of AIF using anti-AIF antibody.Lane 1:rat spleen tissue;2:rat ovary tissue;3:rat lung tissue;4:rat liver tissue;5:mouse spleen tissue;6:mouse testis tissue;7:mouse lung tissue;8:mouse liver tissue;9:mouse ovary tissue.

    AIF/AIFM1 Antibody

    IF analysis of AIF using anti-AIF antibody. AIF was detected in immunocytochemical section of NIH3T3 cells.

    AIF/AIFM1 Antibody

    IF analysis of AIF using anti-AIF antibody. AIF was detected in immunocytochemical section of MCF-7 cells.

    AIF/AIFM1 Antibody

    IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Mouse Cardiac Muscle Tissue.

    AIF/AIFM1 Antibody

    IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue.

    AIF/AIFM1 Antibody

    IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.

    AIF/AIFM1 Antibody

    IHC analysis of AIF using anti-AIF antibody.AIF was detected in immunocytochemical section of SMMC-7721 Cell.

    • AIF/AIFM1 Antibody (monoclonal, 2I5) [orb547790]

      FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • AIF/AIFM1 Antibody [orb154596]

      ICC,  IHC,  WB

      Hamster

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 10 μg
    • AIF AIFM1 Rabbit Monoclonal Antibody [orb547789]

      FC,  ICC,  IF,  IHC,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    • AIF (AIFM1) antibody [orb1313655]

      IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • AIF (AIFM1) antibody [orb1313667]

      WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars