You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573872 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AHR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AHR |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 96kDa |
Target | AHR |
UniProt ID | P35869 |
Protein Sequence | Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL |
NCBI | NP_001612 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RP85, bHLHe76 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
AHR antibody - N-terminal region (orb573872) validated by WB using Human HepG2 Lysate at 2.5 ug/ml, 5 ug/ml.
Host: Rabbit, Target Name: AHR, Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: AHR, Positive control (+): A549 (N03), Negative control (-): THP-1 (N30), Antibody concentration: 5 ug/ml.
Lanes: Lane 1: 50 ug HepG2 nuclei extract + benzo[a]pyrene, Lane 2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrene, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:1000, Gene Name: AHR (Arylhydrocarbon receptor).
Rabbit Anti-AHR Antibody, Catalog Number: orb573872, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-AHR Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating