You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443145 |
---|---|
Category | Antibodies |
Description | AHR Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 100 kDa |
UniProt ID | P35869 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Aryl hydrocarbon receptor; Ah receptor; AhR; Class Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U87 cells using anti-AHR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U937 cells using anti-AHR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of human cholangiocarcinoma tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of human tonsil tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of mouse liver tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of human oesophagus squama cancer tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of rat spleen tissue.
IHC analysis of AHR using anti-AHR antibody.AHR was detected in paraffin-embedded section of rat small intestine tissue.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating