You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1714228 |
---|---|
Category | Proteins |
Description | Yeast Recombinant AHA1 Protein |
Tested applications | FA, SDS-PAGE, WB |
Reactivity | Yeast |
Tag | His tag |
Concentration | Lot/batch specific. See included datasheet. |
Purity | > 90% |
MW | ~405 kDa |
Target | AHA1 |
UniProt ID | Q12449 |
Protein Sequence | MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL |
Source | Recombinant |
Expression System | E. coli |
Storage | -20°C |
Buffer/Preservatives | 12.5mM Hepes buffer pH 7.2, 10mM NaCl, 50% glycerol |
Alternative names | Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Read more... |
Note | For research use only |
Application notes | This product has been certified > 90% pure using SDS - PAGE analysis. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating