AGTR2 antibody

• Catalog Number: orb584534
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AGTR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGTR2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: AGTR2
• UniProt ID: P50052
• Protein Sequence: Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT
• NCBI: NP_000677
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AT2, ATGR2, MRX88
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AGTR2 antibody - N-terminal region (orb584534) validated by WB using Fetal Heart at 0.2-1 ug/ml.

AGTR2 antibody - N-terminal region (orb584534) validated by WB using Mouse brain membranes at 1:4000.