AGR2 monoclonal antibody (M03), clone 1C3

• Catalog Number: orb2291535
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant AGR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
• NCBI: AAH15503.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7.

Detection limit for recombinant GST tagged AGR2 is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3. Lane 1: AGR2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (44.99 KDa).