You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291536 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant AGR2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E5 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
NCBI | AAH15503.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in human colon.
AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in MCF-7.
Detection limit for recombinant GST tagged AGR2 is approximately 3 ng/ml as a capture antibody.
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M01), clone 1E5. Lane 1: AGR2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (44.99 KDa).