AGR2 monoclonal antibody (M01), clone 1E5

• Catalog Number: orb2291536
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant AGR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
• NCBI: AAH15503.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in human colon.

AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in MCF-7.

Detection limit for recombinant GST tagged AGR2 is approximately 3 ng/ml as a capture antibody.

Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M01), clone 1E5. Lane 1: AGR2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (44.99 KDa).