AGER antibody

• Catalog Number: orb578077
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AGER
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGER
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: AGER
• UniProt ID: Q15109
• Protein Sequence: Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT
• NCBI: NP_751947
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RAGE, sRAGE, SCARJ1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: AGER, Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: AGER, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Lane 1: 10 ug of hRAGE HEK-293 lysate, Lane 2: 10 ug of mRAGE HEK-293 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:2500, Gene Name: AGER.

WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.