You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574827 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AFM |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AFM |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 69kDa |
Target | AFM |
UniProt ID | P43652 |
Protein Sequence | Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR |
NCBI | NP_001124 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ALF, ALB2, ALBA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: AFM, Positive control (+): Human Placenta (PL), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-AFM Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating