ADSL antibody

• Catalog Number: orb584531
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADSL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADSL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: ADSL
• UniProt ID: P30566
• Protein Sequence: Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI
• NCBI: NP_000017
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ASL, AMPS, ASASE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. Hamster CHO K1 cells (20 ug), 2. HeLa skin cells(100 ug), 3. HEK273 cells (100 ug), 4. HepG2 cells (100 ug), 5. purified human ADSL protein (40 ng), Primary dilution: 1:2000, Secondary Antibody: Clean-Blot IP detection Reagent and Kit, Secondary dilution: 1:2000.

Host: Rabbit, Target Name: ADSL, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-ADSL Antibody, Catalog Number: orb584531, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in endothelial cells in blood vessels, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.