You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584531 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ADSL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADSL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | ADSL |
UniProt ID | P30566 |
Protein Sequence | Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI |
NCBI | NP_000017 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ASL, AMPS, ASASE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Hamster CHO K1 cells (20 ug), 2. HeLa skin cells(100 ug), 3. HEK273 cells (100 ug), 4. HepG2 cells (100 ug), 5. purified human ADSL protein (40 ng), Primary dilution: 1:2000, Secondary Antibody: Clean-Blot IP detection Reagent and Kit, Secondary dilution: 1:2000.
Host: Rabbit, Target Name: ADSL, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-ADSL Antibody, Catalog Number: orb584531, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in endothelial cells in blood vessels, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
IHC-P, WB | |
Bovine, Canine, Equine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating