You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331037 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ADRM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig, Human, Mouse, Rat |
Reactivity | Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | ADRM1 |
UniProt ID | Q16186 |
Protein Sequence | Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE |
NCBI | NP_783163 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARM1 antibody, anti GP110 antibody, anti MGC2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Lung tissue using ADRM1 antibody
Western blot analysis of human 721_B tissue using ADRM1 antibody
Western blot analysis of human Hela tissue using ADRM1 antibody
Western blot analysis of human Placenta tissue using ADRM1 antibody
Western blot analysis of HeLa cells and cytosol from male mouse liver tissue using ADRM1 antibody
Western blot analysis of human Fetal Brain tissue using ADRM1 antibody
Western blot analysis of human Fetal Heart tissue using ADRM1 antibody
Host: Rabbit, Target Name: ADRM1, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ADRM1, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: ADRM1, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADRM1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADRM1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADRM1, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in HeLa.
WB Suggested Anti-ADRM1 antibody, Titration: 1 ug/ml, Positive Control: HeLa cells and cytosol from male mouse liver.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P | |
Bovine, Canine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating