ADPGK antibody

• Catalog Number: orb575175
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADPGK
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: ADPGK
• UniProt ID: Q9BRR6
• Protein Sequence: Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV
• NCBI: NP_112574
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ADP-GK, 2610017G09Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ADPGK, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HEK293T.

Host: Rabbit, Target Name: ADPGK, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ADPGK, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, ADPGK is supported by BioGPS gene expression data to be expressed in COLO205.