You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575175 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ADPGK |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | ADPGK |
UniProt ID | Q9BRR6 |
Protein Sequence | Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV |
NCBI | NP_112574 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ADP-GK, 2610017G09Rik Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ADPGK, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HEK293T.
Host: Rabbit, Target Name: ADPGK, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADPGK, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ADPGK, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, ADPGK is supported by BioGPS gene expression data to be expressed in COLO205.
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating