You have no items in your shopping cart.
Cart summary
Item 1 of 1
ADM2 antibody
Catalog Number: orb586050
| Catalog Number | orb586050 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ADM2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC |
| Predicted Reactivity | Bovine, Equine, Human, Mouse, Porcine, Rat |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 16 kDa |
| Target | ADM2 |
| UniProt ID | Q7Z4H4 |
| Protein Sequence | Synthetic peptide located within the following region: GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS |
| NCBI | NP_079142 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | AM2, dJ579N16.4 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Rabbit Anti-ADM2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
- Item 1 of 3
Intermedin antibody [orb101145]
IHC-P, WB
Equine, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
