You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381035 |
---|---|
Category | Antibodies |
Description | Adenylate Kinase 1/AK1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Predicted Reactivity | Bovine, Canine, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 21635 MW |
UniProt ID | P00568 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Adenylate kinase isoenzyme 1 ;AK 1 ;2.7.4.3 ;2.7.4 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-Adenylate Kinase 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Adenylate Kinase 1 using anti-Adenylate Kinase 1 antibody.Lane 1:rat skeletal muscle tissue; 2:mouse cardiac muscle tissue.3:COLO320 cell.
IF analysis of Adenylate Kinase 1 using anti-Adenylate Kinase 1 antibody. Adenylate Kinase 1 was detected in immunocytochemical section of U20S cells.
IF, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating