ACVR2B antibody

• Catalog Number: orb579375
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACVR2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACVR2B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ACVR2B
• UniProt ID: Q13705
• Protein Sequence: Synthetic peptide located within the following region: LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
• NCBI: NP_001097
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HTX4, ACTRIIB, ActR-IIB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: ACVR2B, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: FAM46C, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GNAS, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-ACVR2B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate.