ACVR1 antibody

• Catalog Number: orb330399
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACVR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57 kDa
• Target: ACVR1
• UniProt ID: Q04771
• Protein Sequence: Synthetic peptide located within the following region: TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL
• NCBI: NP_001096
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACTRI antibody, anti ACVRLK2 antibody, anti A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Host: Rabbit, Target Name: ACVR1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Human Muscle

WB Suggested Anti-ACVR1 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.