You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330398 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACVR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | ACVR1 |
UniProt ID | Q04771 |
Protein Sequence | Synthetic peptide located within the following region: EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP |
NCBI | NP_001096 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ACTRI antibody, anti ACVRLK2 antibody, anti A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: ACVR1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: ACVR1, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: ACVR1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-ACVR1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating