You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330662 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACTR1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ACTR1B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | ACTR1B |
UniProt ID | P42025 |
Protein Sequence | Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF |
NCBI | NP_005726 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARP1B antibody, anti CTRN2 antibody, anti PC3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ACTR1B, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ACTR1B is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, ACTR1B is supported by BioGPS gene expression data to be expressed in HepG2.
ICC, IHC-Fr, IHC-P, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating