ACTR1B antibody

• Catalog Number: orb330662
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACTR1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACTR1B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: ACTR1B
• UniProt ID: P42025
• Protein Sequence: Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
• NCBI: NP_005726
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARP1B antibody, anti CTRN2 antibody, anti PC3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ACTR1B, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ACTR1B is supported by BioGPS gene expression data to be expressed in 721_B.

Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ACTR1B, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, ACTR1B is supported by BioGPS gene expression data to be expressed in HepG2.