ACTN4 monoclonal antibody (M01A), clone 4D10

• Catalog Number: orb2296436
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACTN4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D10
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
• NCBI: NP_004915
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7.

ACTN4 monoclonal antibody (M01A), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3.

Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01A), clone 4D10. Lane 1: ACTN4 transfected lysate(104.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).