You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583986 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACTN1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 103kDa |
Target | ACTN1 |
UniProt ID | P12814 |
Protein Sequence | Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
NCBI | NP_001093 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BDPLT15 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1.-4. rACTN1-GFP + HEK293 (50 ug), Primary dilution: 1:1000-1:2000, Secondary Antibody: HRP conjugated goat anti-rabbit, Secondary dilution: 1:20000.
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
ACTN1 antibody - N-terminal region (orb583986) validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30 ug), 2. Rat cortical neurons ACTN1 siRNA (30 ug) at 1:1000-1:2000.
Host: Rabbit, Target Name: ACTN1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ACTN1.
Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN1, Gene Name: ACTN1.
WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating