ACTB Rabbit Polyclonal Antibody

• Catalog Number: orb577463
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACTB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Goat, Porcine, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: ACTB
• UniProt ID: P60709
• Protein Sequence: Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
• NCBI: NP_001092
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BRWS1, PS1TP5BP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

1. The sample 1 - 8 is used N2 wild type C. elegans. 2. Each lane contain 60 ug of sample and the loading volume is 36 ul. 3. The number 1 sample is a control without any treatment. 4. As I get 50 ug of primary Ab, I diluted with 50 ul of water. I use 5 ul each time in 10 ml of 5% milk in PBST buffer. 5. The secondary antibody for chemiluminescence is Peroxidase-AffiniPure Goat Anti-Rabbit IgG (H+L); for the chromogenic detection, I used goat anti-rabbit IgG-Ap (sc-2007).

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1 ug/ml.

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Rabbit Anti-ACTB Antibody, Catalog Number: orb577463, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample type: 1-8.N2 WT C elegans (60 ug), Primary Dilution: 1:2000, Secondary Antibody: goat anti-Rabbit HRP, Secondary Dilution: 1:2000.

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: ACTB: Red DAPI:Blue, Gene Name: ACTB.

WB Suggested Anti-ACTB Antibody, Positive Control: Lane 1: 30 ug mouse 3T3 ECM extract + blocking peptide, Lane 2: 30 ug mouse 3T3 ECM extract, Lane 3: 30 ug Echinococcus granulosus extract, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T.