ACSL1 antibody

• Catalog Number: orb574385
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACSL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: ACSL1
• UniProt ID: P33121
• Protein Sequence: Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY
• NCBI: NP_001986
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACS1, LACS, FACL1, FACL2, LACS1, LACS2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage activated with iMtb, Primary antibody dilution: Primary ab dil: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.