ACOX3 antibody

• Catalog Number: orb584803
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACOX3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACOX3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 77kDa
• Target: ACOX3
• UniProt ID: O15254
• Protein Sequence: Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT
• NCBI: NP_003492
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: ACOX3, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-ACOX3 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. ACOX3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.