Aconitase 2 Antibody (monoclonal, 4C12D1)

• Catalog Number: orb1184737
• Category: Antibodies
• Description: Aconitase 2 Antibody (monoclonal, 4C12D1)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C12D1
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 85 kDa
• UniProt ID: Q99798
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of mouse heart tissue.

IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody. Aconitase 2 was detected in a paraffin-embedded section of rat heart tissue.

Western blot analysis of Aconitase 2 using anti-Aconitase 2 antibody.