ACO2 Rabbit Polyclonal Antibody

• Catalog Number: orb330838
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACO2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Porcine, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACO2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 82kDa
• Target: ACO2
• UniProt ID: Q99798
• Protein Sequence: Synthetic peptide located within the following region: RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
• NCBI: NP_001089
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACONM antibody, anti MGC20605 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Kidney Cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human brain (BR), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/ml.

Rabbit Anti-ACO2 Antibody, Catalog Number: orb330838, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of penealocytes and connective tissue (septum, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.