ACO2 Rabbit Polyclonal Antibody

• Catalog Number: orb330837
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACO2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Yeast
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACO2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 82kDa
• Target: ACO2
• UniProt ID: Q99798
• Protein Sequence: Synthetic peptide located within the following region: LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA
• NCBI: NP_001089
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACONM antibody, anti MGC20605 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACO2 antibody - N-terminal region (orb330837) validated by WB using Proximal kidney tubules purfied from cortex at 5.0 ug/ml.

WB Suggested Anti-ACO2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, ACO2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.