ACO1 antibody

• Catalog Number: orb330127
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACO1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: ACO1
• UniProt ID: P28271
• Protein Sequence: Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
• NCBI: NP_002188
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IRP1 antibody, anti ACONS antibody, anti IREB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HePG2 tissue using ACO1 antibody

Western blot analysis of human kidney tissue using ACO1 antibody

Immunohistochemical staining of human Skeletal muscle tissue using ACO1 antibody

Immunohistochemical staining of human Capan1 tissue using ACO1 antibody

Western blot analysis of mouse liver tissue using ACO1 antibody

Western blot analysis of human capan1, HPAF tissue using ACO1 antibody

Host: Rabbit, Target Name: ACO1, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ACO1, Sample Type: Fetal Kidney, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Lane 1: 100 ug HePG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:8000, Gene Name: ACO1.

Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACO1.

Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: ACO1.

Rabbit Anti-ACO1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: ACO1: Green DAPI: Blue, Gene Name: ACO1.

WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney.