ACADVL antibody

• Catalog Number: orb330757
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACADVL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ACADVL
• UniProt ID: P49748
• Protein Sequence: Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ
• NCBI: NP_001029031
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACAD6 antibody, anti LCACD antibody, anti VLC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: Normal controls Normal enzyme expression, 2: Normal controls Normal enzyme expression, 3: Positive mutants Defective enzyme expression, 4: Positive mutants Defective enzyme expression, 5: Positive mutants Defective enzyme expression, Primary Antibody dilution: 1:2000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: ACADVL.

WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, ACADVL is supported by BioGPS gene expression data to be expressed in ACHN.