You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330757 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACADVL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | ACADVL |
UniProt ID | P49748 |
Protein Sequence | Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ |
NCBI | NP_001029031 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ACAD6 antibody, anti LCACD antibody, anti VLC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1: Normal controls Normal enzyme expression, 2: Normal controls Normal enzyme expression, 3: Positive mutants Defective enzyme expression, 4: Positive mutants Defective enzyme expression, 5: Positive mutants Defective enzyme expression, Primary Antibody dilution: 1:2000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: ACADVL.
WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, ACADVL is supported by BioGPS gene expression data to be expressed in ACHN.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating