You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381042 |
---|---|
Category | Antibodies |
Description | ABP1/AOC1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IHC, WB |
Reactivity | Human, Monkey |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 85378 MW |
UniProt ID | P19801 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Amiloride-sensitive amine oxidase [copper-containi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody.Lane 1:human 293T cell; 2:human HK-2 cell; 3:monkey COS-7 cell.
IF analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in an immunocytochemical section of T-47D cells.
IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human colonic adenoma tissue.
IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human placenta tissue.
IHC analysis of ABP1/AOC1 using anti-ABP1/AOC1 antibody. ABP1/AOC1 was detected in a paraffin-embedded section of human renal cell carcinoma tissue.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Monkey | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating