You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581435 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ABAT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ABAT |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | ABAT |
UniProt ID | P80404 |
Protein Sequence | Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
NCBI | NP_065737 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GABAT, NPD009, GABA-AT Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-ABAT Antibody, Catalog Number: orb581435, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ABAT Antibody, Catalog Number: orb581435, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ABAT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating