You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495092 |
---|---|
Category | Proteins |
Description | A36R-p43-50 Recombinant Protein |
Species/Host | E. coli |
Tag | His-tag |
MW | ~33kDa |
UniProt ID | Q911X0 |
Solubility (25°C) | 0.5M Urea, PH7.4 |
Protein Sequence | HMCRKKIRTVYNDNKIIMTKLKKIKSPNSSKSSKSTDSESDWEDHCSAMEQNNDVDNISRNEILNDDSFAGSLIWDNESNIMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINDTETVEILNEDTKQIPSYSSNPFVNYNKTSICSKSNPFIAELNNKFSDNNPFRRAHSDDYLNKQQDHEHDDIESSVVSLVLE |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Buffer/Preservatives | 0.5M Urea, pH 7.4 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating