A36R-EEV Recombinant Protein

• Catalog Number: orb1495093
• Category: Proteins
• Description: A36R-EEV Recombinant Protein
• Species/Host: E. coli
• Tag: His-tag
• MW: ~13kDa
• UniProt ID: Q5IXM9
• Solubility (25°C): 2M Urea, PH7.4
• Protein Sequence: HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE
• Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Buffer/Preservatives: 2M Urea, pH 7.4
• Note: For research use only
• Expiration Date: 6 months from date of receipt.