A1CF antibody

• Catalog Number: orb577911
• Category: Antibodies
• Description: Rabbit polyclonal antibody to A1CF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1CF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65kDa
• Target: A1CF
• UniProt ID: Q9NQ94
• Protein Sequence: Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
• NCBI: NP_620311
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACF, ASP, ACF64, ACF65, APOBEC1CF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: A1CF, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target: A1CF, Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-A1CF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. A1CF is supported by BioGPS gene expression data to be expressed in HepG2.