You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577911 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to A1CF |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human A1CF |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 65kDa |
Target | A1CF |
UniProt ID | Q9NQ94 |
Protein Sequence | Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP |
NCBI | NP_620311 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ACF, ASP, ACF64, ACF65, APOBEC1CF Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: A1CF, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: A1CF, Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-A1CF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. A1CF is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating