Cart summary

You have no items in your shopping cart.

    14-3-3 zeta/delta/YWHAZ Antibody (monoclonal, 6H7)

    Catalog Number: orb654291

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb654291
    CategoryAntibodies
    Description14-3-3 zeta/delta/YWHAZ Antibody (monoclonal, 6H7)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number6H7
    Tested applicationsWB
    ReactivityHuman, Monkey, Mouse, Rat
    IsotypeMouse IgG1
    ImmunogenA synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW28 kDa
    UniProt IDP63104
    Sensitivity> 5000 cells
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative names14-3-3 protein zeta/delta; Protein kinase C inhibi
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    14-3-3 zeta/delta/YWHAZ Antibody (monoclonal, 6H7)

    Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody (orb654291). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HeLa whole cell lysates; Lane 2: human A549 whole cell lysates; Lane 3: monkey COS-7 whole cell lysates; Lane 4: human Raji whole cell lysates; Lane 5: huamn Caco-2 whole cell lysates; Lane 6: huamn Jurkat whole cell lysates; Lane 7: mouse brain tissue lysates; Lane 8: rat brain tissue lysates After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-14-3-3 zeta/delta antigen affinity purified monoclonal antibody (Catalog # orb654291) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for 14-3-3 zeta/delta at approximately 28KD. The expected band size for 14-3-3 zeta/delta is at 28KD.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars