You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb654291 |
---|---|
Category | Antibodies |
Description | 14-3-3 zeta/delta/YWHAZ Antibody (monoclonal, 6H7) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6H7 |
Tested applications | WB |
Reactivity | Human, Monkey, Mouse, Rat |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 28 kDa |
UniProt ID | P63104 |
Sensitivity | > 5000 cells |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | 14-3-3 protein zeta/delta; Protein kinase C inhibi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody (orb654291). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HeLa whole cell lysates; Lane 2: human A549 whole cell lysates; Lane 3: monkey COS-7 whole cell lysates; Lane 4: human Raji whole cell lysates; Lane 5: huamn Caco-2 whole cell lysates; Lane 6: huamn Jurkat whole cell lysates; Lane 7: mouse brain tissue lysates; Lane 8: rat brain tissue lysates After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-14-3-3 zeta/delta antigen affinity purified monoclonal antibody (Catalog # orb654291) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for 14-3-3 zeta/delta at approximately 28KD. The expected band size for 14-3-3 zeta/delta is at 28KD.
Filter by Rating