You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb413035 |
---|---|
Category | Antibodies |
Description | 14-3-3 zeta/delta/YWHAZ Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 28 kDa |
UniProt ID | P63104 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | 14-3-3 protein zeta/delta; Protein kinase C inhibi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U20S cells using anti-YWHAZ antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human HepG2 cell;4:human A549 cell;5:human PANC-1 cell;6:human SK-OV-3 cell;7:human 22RV1 cell.
WB analysis using anti-14-3-3 zeta/delta antibody.Lane 1:rat brain tissue;2:rat spleen tissue;3:rat lung tissue;4:rat liver tissue;5:mouse brain tissue;6:mouse spleen tissue;7:mouse lung tissue;8:mouse liver tissue;9:mouse kidney tissue.
IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A431 cell.
IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in immunocytochemical section of A549 cell.
IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat kidney tissue.
IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of rat small intestine tissue.
IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody.14-3-3 zeta/delta was detected in paraffin-embedded section of mouse small intestine tissues.
FC, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating